RetrogeneDB ID: | retro_ptro_153 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 1:54567925..54568165(+) | ||
| Located in intron of: | ENSPTRG00000000765 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | COX7B | ||
| Ensembl ID: | ENSPTRG00000022049 | ||
| Aliases: | None | ||
| Description: | cytochrome c oxidase subunit VIIb [Source:HGNC Symbol;Acc:2291] |
| Percent Identity: | 83.75 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | MFPLVKNALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCIVTWTYVATQVGIEWNLSPVG |
| MF.LVKNA..RLQV.SIQQTMARQSH.KRTPDFHDKYG.AVLASG.TFCI..WT.VATQ..IEWNLSPVG | |
| Retrocopy | MFLLVKNAPSRLQV*SIQQTMARQSHRKRTPDFHDKYGSAVLASGTTFCIAIWT*VATQIRIEWNLSPVG |
| Parental | RVTPKEWRNQ |
| RVTPKEWR.Q | |
| Retrocopy | RVTPKEWRDQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 79 .65 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 29 .36 RPM |
| SRP007412_heart | 0 .03 RPM | 221 .92 RPM |
| SRP007412_kidney | 0 .00 RPM | 200 .35 RPM |
| SRP007412_liver | 0 .00 RPM | 41 .41 RPM |
| SRP007412_testis | 0 .00 RPM | 4 .85 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_157 |
| Gorilla gorilla | retro_ggor_245 |
| Pongo abelii | retro_pabe_465 |