RetrogeneDB ID: | retro_mmul_571 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 1:192899362..192899602(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.84 | ||
| Ensembl ID: | ENSMMUG00000015861 | ||
| Aliases: | None | ||
| Description: | cytochrome c oxidase subunit 7B, mitochondrial [Source:RefSeq peptide;Acc:NP_001245069] |
| Percent Identity: | 80.0 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MFPLVKNALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLAGGATFCIATWTYVATQIGIEWNLSPVG |
| MFPLVK..L..L.V.SIQQ.MARQSHQKRT.DFHDK.GNAVLA.G.TFCIA.WTYVATQIGI..NLSPVG | |
| Retrocopy | MFPLVKTSLSHLHVPSIQQIMARQSHQKRTSDFHDKGGNAVLANGDTFCIAVWTYVATQIGIIGNLSPVG |
| Parental | RVTPKEWRNQ |
| RVT.KEWR.Q | |
| Retrocopy | RVTLKEWRDQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 82 .92 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 87 .10 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 87 .43 RPM |
| SRP007412_heart | 0 .00 RPM | 217 .52 RPM |
| SRP007412_kidney | 0 .00 RPM | 205 .86 RPM |
| SRP007412_liver | 0 .00 RPM | 146 .42 RPM |
| SRP007412_testis | 0 .04 RPM | 6 .78 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_462 |
| Pan troglodytes | retro_ptro_349 |
| Gorilla gorilla | retro_ggor_443 |
| Pongo abelii | retro_pabe_270 |