RetrogeneDB ID: | retro_cjac_973 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 12:35277437..35277678(+) | ||
| Located in intron of: | ENSCJAG00000013537 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | COX7B | ||
| Ensembl ID: | ENSCJAG00000004045 | ||
| Aliases: | None | ||
| Description: | cytochrome c oxidase subunit VIIb [Source:HGNC Symbol;Acc:2291] |
| Percent Identity: | 65.06 % |
| Parental protein coverage: | 98.77 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 3 |
| Parental | FPLVKNALSRLQVRSIQQTMARQSHQ-KRTPDFHDKYGNAILAGGATFCIT-MWTYVITQIGIEWNLSPV |
| FPL.....S.L.V.SIQQT..RQS.Q...T.DFHDKYGN..LAGGA.F.I...WTYV.TQIGI.WNL.PV | |
| Retrocopy | FPLANSTVSNLRVQSIQQTIERQSCQ<ECTHDFHDKYGNSVLAGGASFSIA>VWTYVATQIGIGWNLCPV |
| Parental | GRVTPK-EWRNQQ |
| .RVTP..EWR.QQ | |
| Retrocopy | ARVTPN>EWRDQQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .07 RPM | 21 .43 RPM |
| SRP051959_heart | 0 .09 RPM | 62 .41 RPM |
| SRP051959_kidney | 0 .00 RPM | 40 .87 RPM |
| SRP051959_liver | 0 .00 RPM | 40 .59 RPM |
| SRP051959_lung | 0 .03 RPM | 12 .51 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 13 .08 RPM |
| SRP051959_skeletal_muscle | 0 .13 RPM | 84 .12 RPM |
| SRP051959_spleen | 0 .00 RPM | 20 .82 RPM |