RetrogeneDB ID: | retro_etel_910 | ||
Retrocopy location | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
| Coordinates: | scaffold_183555:5619..5851(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | COX7B | ||
| Ensembl ID: | ENSETEG00000016695 | ||
| Aliases: | None | ||
| Description: | cytochrome c oxidase subunit VIIb [Source:HGNC Symbol;Acc:2291] |
| Percent Identity: | 61.73 % |
| Parental protein coverage: | 98.75 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | MFPLAKNALSRLQMRSIQQAMARHSHQKRA-PDFHDKYGNAILASGATFCIAVWTYTATQVGIQWN-LSP |
| .F.L.KN.L...Q..SIQQAMARH.HQK.A..DFHDKYGNA.LA.GAT.C..VWTY.AT.....WN...P | |
| Retrocopy | IFLLVKNSLRCFQV*SIQQAMARHRHQKGA>SDFHDKYGNAVLATGATCCTDVWTYIATS---SWNRTEP |
| Parental | IGRVTPKEWRD |
| .GR...KEWRD | |
| Retrocopy | VGRIISKEWRD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |