RetrogeneDB ID: | retro_pabe_836 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 12:38474379..38474613(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | COX7B | ||
| Ensembl ID: | ENSPPYG00000020494 | ||
| Aliases: | None | ||
| Description: | Cytochrome c oxidase subunit 7B, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q5R9K2] |
| Percent Identity: | 64.56 % |
| Parental protein coverage: | 98.75 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | FPLVKNALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCIVTWTYVATQVGIEWNLSPVGR |
| FPL.KN.L....V.SI.QT..RQSHQK..PDFHDKY.NAVLASGAT......TY..TQ.GI.W.LSPV.. | |
| Retrocopy | FPLAKNELFCH*V*SIHQTITRQSHQKPIPDFHDKYRNAVLASGAT-PVYLCTYTSTQIGIQWKLSPVSK |
| Parental | VTPKEWRNQ |
| .TPKEW.NQ | |
| Retrocopy | ATPKEWKNQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 35 .28 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 65 .66 RPM |
| SRP007412_heart | 0 .00 RPM | 213 .64 RPM |
| SRP007412_kidney | 0 .00 RPM | 74 .08 RPM |
| SRP007412_liver | 0 .00 RPM | 45 .60 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_988 |
| Pan troglodytes | retro_ptro_760 |
| Macaca mulatta | retro_mmul_800 |