RetrogeneDB ID: | retro_ptro_12 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 4:85327917..85328163(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSPTRG00000016027 | |
| Aliases: | None | ||
| Status: | KNOWN_PROTEIN_CODING | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | COX7B | ||
| Ensembl ID: | ENSPTRG00000022049 | ||
| Aliases: | None | ||
| Description: | cytochrome c oxidase subunit VIIb [Source:HGNC Symbol;Acc:2291] |
| Percent Identity: | 72.5 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MFPLVKNALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCIVTWTYVATQVGIEWNLSPVG |
| MFPL..NAL..L..RSI.Q.MAR.SH.K..PDFHDKYGNAVLASG..FC..TW...ATQ.GIEWNLSPVG | |
| Retrocopy | MFPLARNALSSLKIRSILQSMARHSHVKHSPDFHDKYGNAVLASGTAFCVATWVFTATQIGIEWNLSPVG |
| Parental | RVTPKEWRNQ |
| RVTPKEW..Q | |
| Retrocopy | RVTPKEWKHQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .02 RPM | 79 .65 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 29 .36 RPM |
| SRP007412_heart | 0 .00 RPM | 221 .92 RPM |
| SRP007412_kidney | 0 .00 RPM | 200 .35 RPM |
| SRP007412_liver | 0 .00 RPM | 41 .41 RPM |
| SRP007412_testis | 10 .96 RPM | 4 .85 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_16 |
| Pongo abelii | retro_pabe_22 |
| Macaca mulatta | retro_mmul_1941 |
| Callithrix jacchus | retro_cjac_345 |
| Sus scrofa | retro_sscr_991 |