RetrogeneDB ID: | retro_etel_1736 | ||
Retrocopy location | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
| Coordinates: | scaffold_290696:6548..6788(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | COX7B | ||
| Ensembl ID: | ENSETEG00000016695 | ||
| Aliases: | None | ||
| Description: | cytochrome c oxidase subunit VIIb [Source:HGNC Symbol;Acc:2291] |
| Percent Identity: | 56.25 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MFPLAKNALSRLQMRSIQQAMARHSHQKRAPDFHDKYGNAILASGATFCIAVWTYTATQVGIQWNLSPIG |
| MFP..KN.L..LQ....QQ.MAR..HQ..AP.F.DK.GN..LA.G..F..AV.T.T.TQ.GI.W...P.G | |
| Retrocopy | MFPFTKNPLKPLQVQNMQQMMARQCHQNQAPEFQDKHGNGALAGGVAFRVAV*TCTTTQIGIEWSPFPVG |
| Parental | RVTPKEWRDK |
| RVT.KEWRD. | |
| Retrocopy | RVTSKEWRDQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |