RetrogeneDB ID: | retro_amel_669 | ||
Retrocopy location | Organism: | Panda (Ailuropoda melanoleuca) | |
| Coordinates: | GL192561.1:908750..908983(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | COX7B | ||
| Ensembl ID: | ENSAMEG00000006153 | ||
| Aliases: | None | ||
| Description: | cytochrome c oxidase subunit VIIb [Source:HGNC Symbol;Acc:2291] |
| Percent Identity: | 53.75 % |
| Parental protein coverage: | 92.94 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | SFRMFPMARTALSRLRVQ-SIPQTMARQSHQKRTPDFHDKYGNAVLASGATFCIAVWAYTATQIGIEWNL |
| .F.MFP.AR..L...R...SI.Q.MARQSH.K...DF.DK.GN...AS..TFC..V......QI..EWNL | |
| Retrocopy | TFMMFPLARNILRISRIE<SIEQIMARQSHIKYSLDFLDK*GNSAPASRTTFCV-VRIFRVIQIELEWNL |
| Parental | SPVGRVTPKE |
| S.VG.VT.KE | |
| Retrocopy | SSVGGVTTKE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |