RetrogeneDB ID: | retro_pabe_986 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 13:26368033..26368226(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSPPYG00000011205 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 65.67 % |
| Parental protein coverage: | 78.31 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | QNDAGEFVDLYVPRKCSASNRIIGAK-DHASIQMNV-AEVDKVTGRFNGQFKTYAICGAIRRMGESD |
| QN.A.EFVDLY.P.KCS.SN..IGAK.DH.S.QMN....VD.V.GRFN..FKTY.I..AIR.MGES. | |
| Retrocopy | QNNASEFVDLYIPWKCSTSNHVIGAK<DHTSMQMNM<GKVDQVMGRFNDPFKTYVIHRAIRGMGESE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .03 RPM | 0 .00 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1179 |
| Gorilla gorilla | retro_ggor_917 |
| Macaca mulatta | retro_mmul_1279 |
| Callithrix jacchus | retro_cjac_2572 |