RetrogeneDB ID: | retro_ggor_1647 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 2a:92698151..92698315(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ENSG00000171858 | ||
| Ensembl ID: | ENSGGOG00000023745 | ||
| Aliases: | None | ||
| Description: | 40S ribosomal protein S21 [Source:UniProtKB/TrEMBL;Acc:G3RQI6] |
| Percent Identity: | 69.64 % |
| Parental protein coverage: | 66.27 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MQNDAGEFVDLYVPRKCSASNRIIGAKDHASIQM-NVAEVDKVTGRFNGQFKTYAI |
| .QN.A.EF.DL.VP.K.SASN..IGAKD..SIQ...VA.VDKV..RFNGQFKTYAI | |
| Retrocopy | VQNNACEFMDLNVPWKYSASNCGIGAKDLTSIQI<KVAKVDKVADRFNGQFKTYAI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 58 .12 RPM |
| SRP007412_cerebellum | 0 .08 RPM | 67 .49 RPM |
| SRP007412_heart | 0 .00 RPM | 31 .83 RPM |
| SRP007412_kidney | 0 .00 RPM | 89 .06 RPM |
| SRP007412_liver | 0 .00 RPM | 98 .05 RPM |
| SRP007412_testis | 0 .00 RPM | 62 .57 RPM |