RetrogeneDB ID: | retro_mmus_992 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 13:12160789..12160967(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Rps21 | ||
| Ensembl ID: | ENSMUSG00000039001 | ||
| Aliases: | Rps21, 1810049N11Rik, 2410030A14Rik | ||
| Description: | ribosomal protein S21 [Source:MGI Symbol;Acc:MGI:1913731] |
| Percent Identity: | 63.33 % |
| Parental protein coverage: | 68.67 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | KDHASIQMN--VAEVDRTTGRFNGQFKTYGICGAIRRMGESDDSILRLAK-ADGIVSKNF |
| KDHAS.QM...VA.VD..T.RFNGQF.T...C.AI..MGES.DS.L.L.K.A.GIVS.NF | |
| Retrocopy | KDHASFQMKMTVATVDKVTDRFNGQFET*AVCRAIHGMGESNDSAL*LTK>AKGIVSRNF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 91 .23 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 56 .40 RPM |
| SRP007412_heart | 0 .00 RPM | 82 .68 RPM |
| SRP007412_kidney | 0 .00 RPM | 73 .67 RPM |
| SRP007412_liver | 0 .00 RPM | 64 .53 RPM |
| SRP007412_testis | 0 .05 RPM | 35 .77 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000017399 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000020795 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000012676 | 4 retrocopies | |
| Callithrix jacchus | ENSCJAG00000014195 | 5 retrocopies | |
| Homo sapiens | ENSG00000171858 | 6 retrocopies | |
| Gorilla gorilla | ENSGGOG00000023745 | 7 retrocopies | |
| Latimeria chalumnae | ENSLACG00000012753 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000016769 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000039001 | 11 retrocopies | |
| Ornithorhynchus anatinus | ENSOANG00000003361 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000016673 | 12 retrocopies | |
| Pongo abelii | ENSPPYG00000011205 | 8 retrocopies | |
| Pan troglodytes | ENSPTRG00000013708 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000006325 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000021825 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000001029 | 5 retrocopies |