RetrogeneDB ID: | retro_btau_1780 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | X:125195355..125195582(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS21 | ||
| Ensembl ID: | ENSBTAG00000020795 | ||
| Aliases: | None | ||
| Description: | 40S ribosomal protein S21 [Source:UniProtKB/Swiss-Prot;Acc:Q32PB8] |
| Percent Identity: | 70.13 % |
| Parental protein coverage: | 91.57 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | FVDLYVPRKCSASNRIIGAKDHASIQMNVAEVDKVTGRFNGQFKTYAICGAIRRMGESDD-SILRLAKAD |
| F.DLY.P.K.S..N.II..K.HA.IQMNVA.VDKVT.RFNGQFKTY.I..AI.RMGES.D.SIL.LAKA. | |
| Retrocopy | FMDLYMPQKFSSGNPIISTKNHAPIQMNVAKVDKVTVRFNGQFKTYSIYWAIHRMGESED<SILQLAKAK |
| Parental | GIVSKNF |
| .I.SKNF | |
| Retrocopy | AIISKNF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 35 .90 RPM |
| ERP005899_muscle | 0 .00 RPM | 339 .38 RPM |
| SRP017611_brain | 0 .00 RPM | 22 .84 RPM |
| SRP017611_kidney | 0 .00 RPM | 65 .50 RPM |
| SRP017611_liver | 0 .00 RPM | 35 .64 RPM |
| SRP030211_testis | 0 .00 RPM | 60 .34 RPM |