RetrogeneDB ID: | retro_mmus_1837 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 19:53266634..53266861(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Rps21 | ||
| Ensembl ID: | ENSMUSG00000039001 | ||
| Aliases: | Rps21, 1810049N11Rik, 2410030A14Rik | ||
| Description: | ribosomal protein S21 [Source:MGI Symbol;Acc:MGI:1913731] |
| Percent Identity: | 59.26 % |
| Parental protein coverage: | 96.39 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | DAGEFVDLY-VPRKCSASNRIIAAKDHASIQMNVAEVDRTTGRFNGQFKTYGICGAIRRMGESDDSILRL |
| .A..FVDL...P.K.S.SN.I..AKDH.S....VA.V....GR..G.FKTY.ICGAI.R.GE.DDS.L.L | |
| Retrocopy | EASKFVDLD<LPQKWSPSNCIAGAKDHEST*RSVAMV----GRVRGWFKTYAICGAIHRIGELDDSSLHL |
| Parental | AKADGIVSKNF |
| AKAD.IVSK.F | |
| Retrocopy | AKADEIVSKSF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 91 .23 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 56 .40 RPM |
| SRP007412_heart | 0 .00 RPM | 82 .68 RPM |
| SRP007412_kidney | 0 .00 RPM | 73 .67 RPM |
| SRP007412_liver | 0 .00 RPM | 64 .53 RPM |
| SRP007412_testis | 0 .00 RPM | 35 .77 RPM |