RetrogeneDB ID: | retro_rnor_1498 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 2:72493014..72493247(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Atp6v0e1 | ||
| Ensembl ID: | ENSRNOG00000003269 | ||
| Aliases: | Atp6v0e1, Atp6k, Atp6v0e, Dsr-1A, dsr-1 | ||
| Description: | V-type proton ATPase subunit e 1 [Source:UniProtKB/Swiss-Prot;Acc:Q794C0] |
| Percent Identity: | 77.22 % |
| Parental protein coverage: | 96.3 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | HGLTVPLIVMSVFWGFVGLLVPWFIPKGPNR-GVIITMLVTCSVCCYLFWLIAILAQLNPLFGPQLKNET |
| HG...P...........GLLVPWFIPKGPNR.GVIITMLVTCSVCCYLFWLIAILAQLN.LFGPQLKNET | |
| Retrocopy | HGIPQPHSAFNRDERVLGLLVPWFIPKGPNR<GVIITMLVTCSVCCYLFWLIAILAQLNLLFGPQLKNET |
| Parental | IWYLKYHWP |
| I.YLK.HWP | |
| Retrocopy | I*YLKCHWP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 12 .87 RPM |
| SRP017611_kidney | 0 .00 RPM | 82 .34 RPM |
| SRP017611_liver | 0 .00 RPM | 32 .07 RPM |