RetrogeneDB ID: | retro_meug_530 | ||
Retrocopylocation | Organism: | Wallaby (Macropus eugenii) | |
| Coordinates: | Scaffold131807:3656..3820(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | ATP6V0E1 | ||
| Ensembl ID: | ENSMEUG00000008589 | ||
| Aliases: | None | ||
| Description: | ATPase, H+ transporting, lysosomal 9kDa, V0 subunit e1 [Source:HGNC Symbol;Acc:863] |
| Percent Identity: | 57.14 % |
| Parental protein coverage: | 67.9 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 1 |
| Parental | VVGFFVPCFIP-KGPNRGVIITMLITCAVCCYLFWLIAILAQLNPLFGPQLKNETI |
| ..G.FVPCFIP.K.PN....IT.LITC..CCYLF..I.ILA.LNP.F..QL..... | |
| Retrocopy | LMGIFVPCFIP<KCPNQNCSITILITCVLCCYLF*MITILA*LNPFFESQLSQVSL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |