RetrogeneDB ID: | retro_fcat_1282 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
| Coordinates: | C2:89846731..89846972(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | ATP6V0E1 | ||
| Ensembl ID: | ENSFCAG00000031789 | ||
| Aliases: | None | ||
| Description: | ATPase, H+ transporting, lysosomal 9kDa, V0 subunit e1 [Source:HGNC Symbol;Acc:863] |
| Percent Identity: | 73.49 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 2 |
| Parental | MAYNGLTVPLIVMSVFWGFVGFLVPWFIPKGPNRGVIITML-VTCSVCCYLFWLIAILAQ-LNPLFGPQL |
| .A.N.L.VPLIVM.VFWGF.GFLVP.FIPKG...G.IITML.V.CSVCCYLF.LIAILA...NPLFGPQ. | |
| Retrocopy | VACNRLMVPLIVMNVFWGFLGFLVPRFIPKGAGEGIIITML<VACSVCCYLF*LIAILAH<PNPLFGPQW |
| Parental | KNETIWYLKYHWP |
| .NET..YLKYH.P | |
| Retrocopy | ENETS*YLKYH*P |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 10 .90 RPM |
| SRP017611_kidney | 0 .00 RPM | 133 .25 RPM |
| SRP017611_liver | 0 .00 RPM | 30 .73 RPM |