RetrogeneDB ID: | retro_btau_1320 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
| Coordinates: | 4:46656907..46657150(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | ATP6V0E1 | ||
| Ensembl ID: | ENSBTAG00000015100 | ||
| Aliases: | ATP6V0E1, ATP6V0E | ||
| Description: | V-type proton ATPase subunit e 1 [Source:UniProtKB/Swiss-Prot;Acc:P81103] |
| Percent Identity: | 69.14 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | MAYTGLTVPLIVMSVFWGIVGFLVPWFIPKGPNRGVIITMLVTCSVCCYLFWLIAILAQLNPLFGPQLKN |
| MA.T.LTVPL.V...F.G...FLV.WF....P..GVI.T.LVTC.VCCYLFWL..ILAQLNPLFGPQLKN | |
| Retrocopy | MADTSLTVPLNVINEFCGFISFLVSWFHLSIPSWGVITTILVTCLVCCYLFWLVTILAQLNPLFGPQLKN |
| Parental | ETIWYLKYHWP |
| .TIWYLK.H.P | |
| Retrocopy | GTIWYLKHHCP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 52 .56 RPM |
| ERP005899_muscle | 0 .00 RPM | 60 .34 RPM |
| SRP017611_brain | 0 .00 RPM | 7 .86 RPM |
| SRP017611_kidney | 0 .00 RPM | 72 .31 RPM |
| SRP017611_liver | 0 .00 RPM | 42 .96 RPM |
| SRP030211_testis | 0 .03 RPM | 68 .05 RPM |