RetrogeneDB ID: | retro_ogar_1368 | ||
Retrocopylocation | Organism: | Bushbaby (Otolemur garnettii) | |
| Coordinates: | GL873544.1:13114135..13114378(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | ATP6V0E1 | ||
| Ensembl ID: | ENSOGAG00000017071 | ||
| Aliases: | None | ||
| Description: | ATPase, H+ transporting, lysosomal 9kDa, V0 subunit e1 [Source:HGNC Symbol;Acc:863] |
| Percent Identity: | 80.25 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | MAYHGLTVPLIVMSVFWGFVGFIVPWFIPKGPNRGVIITMLVTCSVCCYLFWLIAILAQLNPLFGPQLKN |
| .AYHGL.V.L.V.SVFWGFVGFIVPWFIP.GPN.GVIIT.LVT.SVCCYLFWLIAILAQLNPL.GPQ... | |
| Retrocopy | VAYHGLMVTLTVTSVFWGFVGFIVPWFIPMGPNLGVIITILVTRSVCCYLFWLIAILAQLNPLCGPQMQH |
| Parental | ETIWYLKYHWP |
| ET.WYLK..WP | |
| Retrocopy | ETTWYLKSRWP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |