RetrogeneDB ID: | retro_chof_2141 | ||
Retrocopylocation | Organism: | Sloth (Choloepus hoffmanni) | |
| Coordinates: | scaffold_53028:3765..3999(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | ATP6V0E1 | ||
| Ensembl ID: | ENSCHOG00000004421 | ||
| Aliases: | None | ||
| Description: | ATPase, H+ transporting, lysosomal 9kDa, V0 subunit e1 [Source:HGNC Symbol;Acc:863] |
| Percent Identity: | 72.84 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | MAYNGLTVPLIVMSVFWGFVGLLVPWFIPKGPNRGVIITMLVTCSVCCYLFWLIAILAQLNPLFGPQLKN |
| .AYN.LTVP...MSV.WGFVGL.VPWF..KG.N.GVI....VTCSVCC.LFWL.AI.AQLNPLFGPQL.N | |
| Retrocopy | VAYNSLTVP-VIMSVLWGFVGLFVPWFFSKGSNQGVIVS--VTCSVCC*LFWLTAIPAQLNPLFGPQLQN |
| Parental | ETIWYLKYHWP |
| ET..YLK.HWP | |
| Retrocopy | ETTQYLKNHWP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |