RetrogeneDB ID: | retro_cjac_1923 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 2:72507509..72507714(-) | ||
| Located in intron of: | ENSCJAG00000013322 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | ATP6V0E1 | ||
| Ensembl ID: | ENSCJAG00000019225 | ||
| Aliases: | None | ||
| Description: | ATPase, H+ transporting, lysosomal 9kDa, V0 subunit e1 [Source:HGNC Symbol;Acc:863] |
| Percent Identity: | 65.71 % |
| Parental protein coverage: | 85.19 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | MSVFWGFVGFLVPWFIPKGPNRGVIITMLVTCSVCCY-LFWLIAILAQLNPLFGPQLKNETIWYLKYHWP |
| MS.FWGFVGF.VPWFIPKGPN.G............C..LFWLIAILA..NPL.GP.LK.ET.WYLK.HWP | |
| Retrocopy | MSMFWGFVGFFVPWFIPKGPNWG-VVITMMVTCSVCC>LFWLIAILA*CNPLYGPCLKDETTWYLKHHWP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .62 RPM | 17 .73 RPM |
| SRP051959_heart | 0 .60 RPM | 17 .29 RPM |
| SRP051959_kidney | 0 .64 RPM | 36 .03 RPM |
| SRP051959_liver | 0 .89 RPM | 26 .86 RPM |
| SRP051959_lung | 0 .67 RPM | 21 .28 RPM |
| SRP051959_lymph_node | 0 .73 RPM | 18 .86 RPM |
| SRP051959_skeletal_muscle | 0 .50 RPM | 9 .74 RPM |
| SRP051959_spleen | 0 .90 RPM | 32 .00 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3240 |
| Pan troglodytes | retro_ptro_2190 |
| Gorilla gorilla | retro_ggor_2206 |
| Pongo abelii | retro_pabe_2688 |