RetrogeneDB ID: | retro_cjac_1616 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 17:72272440..72272657(-) | ||
| Located in intron of: | ENSCJAG00000017964 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | ATP6V0E1 | ||
| Ensembl ID: | ENSCJAG00000019225 | ||
| Aliases: | None | ||
| Description: | ATPase, H+ transporting, lysosomal 9kDa, V0 subunit e1 [Source:HGNC Symbol;Acc:863] |
| Percent Identity: | 71.23 % |
| Parental protein coverage: | 88.89 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | LIVMSVFWGFVGFLVPWFIPKGPNRGVIITMLVTCSVCCYLFWLIAI-LAQLNPLFGPQLKNETIWYLKY |
| LIVMSVFWGFVGF..PW.IP.GP..GV..T.L.TCSVCC.LFWLI.I.LAQL.PLF.PQLKNET..Y.K. | |
| Retrocopy | LIVMSVFWGFVGFWEPWLIPQGPDWGVMVTILMTCSVCC*LFWLISI>LAQLSPLFEPQLKNETVCYVKH |
| Parental | HWP |
| ..P | |
| Retrocopy | YCP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .04 RPM | 17 .73 RPM |
| SRP051959_heart | 0 .11 RPM | 17 .29 RPM |
| SRP051959_kidney | 0 .20 RPM | 36 .03 RPM |
| SRP051959_liver | 0 .00 RPM | 26 .86 RPM |
| SRP051959_lung | 0 .16 RPM | 21 .28 RPM |
| SRP051959_lymph_node | 0 .07 RPM | 18 .86 RPM |
| SRP051959_skeletal_muscle | 0 .02 RPM | 9 .74 RPM |
| SRP051959_spleen | 0 .15 RPM | 32 .00 RPM |