RetrogeneDB ID: | retro_trub_23 | ||
Retrocopy location | Organism: | Fugu rubripes (Takifugu rubripes) | |
| Coordinates: | scaffold_1215:34243..34594(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TKT (1 of 3) | ||
| Ensembl ID: | ENSTRUG00000003009 | ||
| Aliases: | None | ||
| Description: | transketolase [Source:HGNC Symbol;Acc:11834] |
| Percent Identity: | 52.99 % |
| Parental protein coverage: | 71.78 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | QQTLQALKNIATRLRINSIKATTAAGSGHPTSCCSVAEIMSVLFFHTMKYRPEDPRHSSNDRFVLSKGHA |
| Q..L......A..LRI.SI.ATT.AGSGHPTS..S.A..M.VL......Y....P.H..NDRF.LSKGHA | |
| Retrocopy | QEQLHQWHELAQQLRIDSIRATTVAGSGHPTSSMSSADLMAVLLTNYLHYDFDNPHHPNNDRFILSKGHA |
| Parental | APVLYAVWAETGYLKENELLNLRKVDSILEGHPVPKQQFVDVATGSL |
| AP.LYA.....G.....EL..LR...S.LEGHP.P....VDVATGSL | |
| Retrocopy | APLLYAMYKAAGVITDEELMSLRQMGSRLEGHPTPVLPWVDVATGSL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000003758 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000007253 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000000072 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000001392 | 1 retrocopy | |
| Homo sapiens | ENSG00000163931 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000005312 | 3 retrocopies | |
| Myotis lucifugus | ENSMLUG00000000943 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000014433 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000021957 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000015904 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000016911 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000009891 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000015024 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000016283 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000016064 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000017349 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000021408 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000012114 | 1 retrocopy | |
| Takifugu rubripes | ENSTRUG00000003009 | 1 retrocopy |
retro_trub_23 ,
|