RetrogeneDB ID: | retro_pabe_1054 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 13:51799304..51799530(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SNRPG | ||
| Ensembl ID: | ENSPPYG00000012324 | ||
| Aliases: | None | ||
| Description: | small nuclear ribonucleoprotein polypeptide G [Source:HGNC Symbol;Acc:11163] |
| Percent Identity: | 72.37 % |
| Parental protein coverage: | 98.68 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MSKAHPPELKKFMDKKLSLKLNGGRHVQGIL-RGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIM |
| MSKA....LK.FM.K.LSLKLNGGRHVQGIL.RGFDPFMNLV.DECVEMA..GQQ.N.G.VVI.GN..I. | |
| Retrocopy | MSKAYLSMLKLFMGKTLSLKLNGGRHVQGIL>RGFDPFMNLVMDECVEMAAGGQQSNTGKVVIQGNGVIL |
| Parental | LEALER |
| L..LE. | |
| Retrocopy | LDFLEQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .11 RPM | 4 .26 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 3 .16 RPM |
| SRP007412_heart | 0 .00 RPM | 6 .86 RPM |
| SRP007412_kidney | 0 .00 RPM | 11 .10 RPM |
| SRP007412_liver | 0 .00 RPM | 8 .17 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1267 |
| Pan troglodytes | retro_ptro_867 |