RetrogeneDB ID: | retro_cfam_1984 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 9:37735167..37735395(+) | ||
| Located in intron of: | ENSCAFG00000032731 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SNRPG | ||
| Ensembl ID: | ENSCAFG00000032595 | ||
| Aliases: | None | ||
| Description: | Canis lupus familiaris small nuclear ribonucleoprotein polypeptide G (SNRPG), mRNA. [Source:RefSeq mRNA;Acc:NM_001252331] |
| Percent Identity: | 100.0 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIML |
| MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIML | |
| Retrocopy | MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIML |
| Parental | EALERV |
| EALERV | |
| Retrocopy | EALERV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .08 RPM | 10 .29 RPM |
| SRP017611_brain | 0 .00 RPM | 2 .78 RPM |
| SRP017611_kidney | 0 .07 RPM | 21 .79 RPM |
| SRP017611_liver | 0 .00 RPM | 3 .84 RPM |