RetrogeneDB ID: | retro_mdom_1945 | ||
Retrocopy location | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 8:266109009..266109237(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SNRPG | ||
| Ensembl ID: | ENSMODG00000011528 | ||
| Aliases: | None | ||
| Description: | small nuclear ribonucleoprotein polypeptide G [Source:HGNC Symbol;Acc:11163] |
| Percent Identity: | 88.16 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMAPGGQQNNIGMVVIRGNSIIML |
| MSKA..PELKKFMDKKLSLKLNGGR..QGILRG.D.FMNLV.DECVEMAPGGQQNNIGMVVI.GNSIIML | |
| Retrocopy | MSKAYLPELKKFMDKKLSLKLNGGRPIQGILRGSDLFMNLVADECVEMAPGGQQNNIGMVVIQGNSIIML |
| Parental | EALERV |
| EALE.V | |
| Retrocopy | EALEQV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 34 .69 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 32 .97 RPM |
| SRP007412_heart | 0 .00 RPM | 18 .34 RPM |
| SRP007412_kidney | 0 .00 RPM | 23 .70 RPM |
| SRP007412_liver | 0 .00 RPM | 29 .71 RPM |
| SRP007412_testis | 0 .00 RPM | 58 .34 RPM |