RetrogeneDB ID: | retro_ecab_693 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 28:7484166..7484393(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SNRPG | ||
| Ensembl ID: | ENSECAG00000019989 | ||
| Aliases: | None | ||
| Description: | small nuclear ribonucleoprotein polypeptide G [Source:HGNC Symbol;Acc:11163] |
| Percent Identity: | 71.43 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMA-TSGQQNNIGMVVIRGNSIIM |
| MSKAHP..LK...DKKLSLKLN..RHV..ILR.FDP..NL.IDEC.E...T.GQQNNIGMVV..GNSI.M | |
| Retrocopy | MSKAHPLDLKNIKDKKLSLKLNSSRHV*RILRAFDPLTNLAIDECMEII<TWGQQNNIGMVVTQGNSITM |
| Parental | LEALERV |
| LEALE.V | |
| Retrocopy | LEALEGV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 10 .98 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 13 .87 RPM |
| SRP021940_embryo | 0 .00 RPM | 36 .95 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 20 .54 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 17 .05 RPM |
| SRP021940_testis | 0 .00 RPM | 20 .14 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Callithrix jacchus | retro_cjac_3314 |