RetrogeneDB ID: | retro_cpor_145 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_0:85514034..85514259(+) | ||
| Located in intron of: | ENSCPOG00000003912 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SNRPG | ||
| Ensembl ID: | ENSCPOG00000025022 | ||
| Aliases: | None | ||
| Description: | small nuclear ribonucleoprotein polypeptide G [Source:HGNC Symbol;Acc:11163] |
| Percent Identity: | 78.67 % |
| Parental protein coverage: | 98.68 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | SKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLE |
| SKAHPP.L.K.MDKKLS.KLNGGRHVQGIL....PFMN..IDE.VEMATSGQQNN...VVI.GNSIIMLE | |
| Retrocopy | SKAHPPKLNKLMDKKLSMKLNGGRHVQGILQRYGPFMNPMIDEYVEMATSGQQNNARLVVI*GNSIIMLE |
| Parental | ALERV |
| ALE.V | |
| Retrocopy | ALEQV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 7 .13 RPM |
| SRP017611_kidney | 0 .10 RPM | 15 .07 RPM |
| SRP017611_liver | 0 .00 RPM | 10 .71 RPM |
| SRP040447_lung | 0 .03 RPM | 14 .33 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 10 .28 RPM |