RetrogeneDB ID: | retro_opri_972 | ||
Retrocopy location | Organism: | Southern American pika (Ochotona princeps) | |
| Coordinates: | scaffold_5144:140710..140936(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPLP1 | ||
| Ensembl ID: | ENSOPRG00000001163 | ||
| Aliases: | None | ||
| Description: | ribosomal protein, large, P1 [Source:HGNC Symbol;Acc:10372] |
| Percent Identity: | 56.58 % |
| Parental protein coverage: | 65.79 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | EDKINALIKAAGVNVEPFWPGLFAKALANVNIGSLICNVGAGGPAPAAGAAP-AGGPAPAAAAAPAEEKK |
| ..K..ALIKAA.VNVE.....LFA..LA.VN.GSL.C.V.AG.PAP.A.AAP....P.P..A.AP..EK. | |
| Retrocopy | QNKTKALIKAACVNVEELRCYLFADELASVNSGSLLCIVRAGRPAPEAAAAP>KQWP*PSTATAPVQEKE |
| Parental | VEAKKE |
| VE.KK. | |
| Retrocopy | VETKKD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |