RetrogeneDB ID: | retro_rnor_1042 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 14:37852589..37852773(-) | ||
| Located in intron of: | ENSRNOG00000025925 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPLP1 | ||
| Ensembl ID: | ENSRNOG00000011955 | ||
| Aliases: | None | ||
| Description: | 60S acidic ribosomal protein P1 [Source:UniProtKB/Swiss-Prot;Acc:P19944] |
| Percent Identity: | 57.58 % |
| Parental protein coverage: | 57.02 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | ASVSELACIYSALILHDDEVTVTEDKINALIKAAGVNVEPFW-PGLFAKALANVNIGSLICNVGAG |
| ASVS.L......L.L....VT..EDK..A.I.AA.VN..P.W.PGLFAKAL..VNIG.LI..VGAG | |
| Retrocopy | ASVSKL----TLLLLAWS*VTRAEDKTIAVIRAADVNTKPLW>PGLFAKALSSVNIGTLIYDVGAG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 0 .93 RPM |
| SRP017611_kidney | 0 .00 RPM | 0 .91 RPM |
| SRP017611_liver | 0 .00 RPM | 0 .47 RPM |