RetrogeneDB ID: | retro_ocun_1196 | ||
Retrocopy location | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | 3:80509416..80509629(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL23 | ||
| Ensembl ID: | ENSOCUG00000013915 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L23 [Source:HGNC Symbol;Acc:10316] |
| Percent Identity: | 58.9 % |
| Parental protein coverage: | 50.71 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | AAGVGDMVMATVKKGKPELRKKV-HPAVVIRQRKSYRR-KDGVFLYFEDNAGVIVNNKGEMKGSAITGPV |
| A..VG..VMATVK.GK.ELRKK..HPAVVI.Q.K..RR.KD..FL..EDN.G.........KGS.ITGPV | |
| Retrocopy | ATAVGGLVMATVKNGK*ELRKKT>HPAVVILQQKLHRR<KDVTFLNSEDNVGIPEKTETHTKGSIITGPV |
| Parental | AKE |
| .K. | |
| Retrocopy | VKQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .06 RPM | 83 .89 RPM |
| SRP017611_kidney | 0 .00 RPM | 165 .82 RPM |
| SRP017611_liver | 0 .00 RPM | 49 .33 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Pongo abelii | retro_pabe_3340 |