RetrogeneDB ID: | retro_ggor_256 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 1:80950419..80950842(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL23 | ||
| Ensembl ID: | ENSGGOG00000025082 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 65.73 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 3 |
| Parental | MSKRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVMATV-KKGK |
| MSK.G.GG.S..K...SLG.P.GA.INC.DNTGAKNLYI.SVKG.KG.LNRL..AGVGDMVM....K... | |
| Retrocopy | MSKQGCGGFSSVKYWNSLGFPIGAKINCVDNTGAKNLYIMSVKGNKGQLNRLSTAGVGDMVMVSQ>KGKQ |
| Parental | PELRKKVHPAVVIR-QRKSYRRKDGVFLYFEDNAGVIVNNKGEM-KGSAITGPVAKECADLWPRIASNAG |
| PELRK.V.PAVV......SY.RK.G.FLYF.DN.GVI.NN.G.M.KG.AI..PV.KECADLWPRI...A. | |
| Retrocopy | PELRKEVYPAVVVQ>XXXSYQRKNGMFLYFADNIGVIENNEGKM>KGPAIIRPVGKECADLWPRIVLDAD |
| Parental | SIA |
| SIA | |
| Retrocopy | SIA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 88 .67 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 83 .41 RPM |
| SRP007412_heart | 0 .00 RPM | 74 .11 RPM |
| SRP007412_kidney | 0 .00 RPM | 374 .17 RPM |
| SRP007412_liver | 0 .00 RPM | 246 .11 RPM |
| SRP007412_testis | 0 .00 RPM | 176 .43 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000004268 | 6 retrocopies | |
| Callithrix jacchus | ENSCJAG00000008311 | 9 retrocopies | |
| Gorilla gorilla | ENSGGOG00000025082 | 9 retrocopies |
retro_ggor_1574, retro_ggor_1744, retro_ggor_1746, retro_ggor_2416, retro_ggor_2508, retro_ggor_256 , retro_ggor_2710, retro_ggor_2757, retro_ggor_504,
|
| Latimeria chalumnae | ENSLACG00000004430 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000004502 | 9 retrocopies | |
| Monodelphis domestica | ENSMODG00000012634 | 3 retrocopies | |
| Mustela putorius furo | ENSMPUG00000015075 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000000642 | 7 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000013915 | 6 retrocopies | |
| Otolemur garnettii | ENSOGAG00000012445 | 7 retrocopies | |
| Ochotona princeps | ENSOPRG00000001957 | 10 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000002277 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000004107 | 10 retrocopies |