RetrogeneDB ID: | retro_mdom_527 | ||
Retrocopy location | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 1:160847129..160847382(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL23 | ||
| Ensembl ID: | ENSMODG00000012634 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L23 [Source:HGNC Symbol;Acc:10316] |
| Percent Identity: | 64.37 % |
| Parental protein coverage: | 60.0 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
| Parental | PAAGVGDMVM-ATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGPV |
| P.AGVGDMV..A.VKKG.PEL.KKV..AV.....K.Y.RKDG.FL.FEDN..VIVNNKG.MKG.A...P. | |
| Retrocopy | PTAGVGDMVITAIVKKGQPEL*KKVD*AVLKCELKLYHRKDGAFLCFEDNEEVIVNNKGKMKGLANMVPF |
| Parental | AK-ECAD-LWPRIASNA |
| AK.ECA..LWP.IA..A | |
| Retrocopy | AK<ECAT<LWPKIATIA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .12 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000004268 | 6 retrocopies | |
| Callithrix jacchus | ENSCJAG00000008311 | 9 retrocopies | |
| Gorilla gorilla | ENSGGOG00000025082 | 9 retrocopies | |
| Latimeria chalumnae | ENSLACG00000004430 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000004502 | 9 retrocopies | |
| Monodelphis domestica | ENSMODG00000012634 | 3 retrocopies |
retro_mdom_1949, retro_mdom_527 , retro_mdom_916,
|
| Mustela putorius furo | ENSMPUG00000015075 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000000642 | 7 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000013915 | 6 retrocopies | |
| Otolemur garnettii | ENSOGAG00000012445 | 7 retrocopies | |
| Ochotona princeps | ENSOPRG00000001957 | 10 retrocopies | |
| Rattus norvegicus | ENSRNOG00000004107 | 10 retrocopies |