RetrogeneDB ID: | retro_mmul_416 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 1:132404673..132404887(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSMMUG00000020073 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 63.64 % |
| Parental protein coverage: | 68.52 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | KAKLVILANNC-PALRKSE-IEYYAMLAKTGVHHYSGNNIELGTACGKYYRVCTLAIID-PGDSDIIRSM |
| K.KLVIL.NNC.P.......I....MLAKTG.HHYSGNN.....A..KYYRVCTLAI....G.SDII.SM | |
| Retrocopy | KVKLVILTNNC<PIFKEIQNIVLNTMLAKTGIHHYSGNNCK---AYRKYYRVCTLAIVK<AGESDIIKSM |
| Parental | PEQTGEK |
| PEQTGEK | |
| Retrocopy | PEQTGEK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 134 .46 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .08 RPM | 106 .54 RPM |
| SRP007412_cerebellum | 0 .19 RPM | 149 .81 RPM |
| SRP007412_heart | 0 .06 RPM | 214 .46 RPM |
| SRP007412_kidney | 0 .23 RPM | 206 .33 RPM |
| SRP007412_liver | 0 .00 RPM | 211 .18 RPM |
| SRP007412_testis | 0 .00 RPM | 115 .04 RPM |