RetrogeneDB ID: | retro_ttru_1871 | ||
Retrocopy location | Organism: | Dolphin (Tursiops truncatus) | |
| Coordinates: | scaffold_96399:354..592(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL30 | ||
| Ensembl ID: | ENSTTRG00000016058 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L30 [Source:HGNC Symbol;Acc:10333] |
| Percent Identity: | 76.25 % |
| Parental protein coverage: | 68.7 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MIRHGKAKLVILANNCPALRKSEIEYYAMLAKTGVHHYSGNNIELGTAC-GKYYRVCTLAIIDPGDSDII |
| M...GK.KLVIL.NNC...RKSEIEYY.MLAKTGVHHYSGNN.E.GT.C.GK.YRVCTL.IID.GDSDII | |
| Retrocopy | MVKQGKVKLVILTNNCHTFRKSEIEYYTMLAKTGVHHYSGNNTEWGTGC>GKNYRVCTLGIIDLGDSDII |
| Parental | RSMPEQTGEK |
| RSM.EQT..K | |
| Retrocopy | RSMSEQTSKK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000016047 | 2 retrocopies | |
| Ailuropoda melanoleuca | ENSAMEG00000000605 | 18 retrocopies | |
| Bos taurus | ENSBTAG00000016278 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000015549 | 4 retrocopies | |
| Felis catus | ENSFCAG00000002165 | 9 retrocopies | |
| Loxodonta africana | ENSLAFG00000002077 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000004620 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000020073 | 12 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000017386 | 4 retrocopies | |
| Tursiops truncatus | ENSTTRG00000016058 | 5 retrocopies |