RetrogeneDB ID: | retro_fcat_1391 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | D1:18356980..18357192(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSFCAG00000002165 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 75.0 % |
| Parental protein coverage: | 61.74 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | LVILANNCPALRKSEIEYYAMLAKTGVHHYSGNNIELGTACGKYYR-VCTLAIIDPGDSDIIRSMPEQTG |
| LVIL..NCPALR.SEIE..AMLAKTGVHHYSGN...LGTA.GKY....CTLA..DPGDSD.I..MPEQTG | |
| Retrocopy | LVILTSNCPALRRSEIEHSAMLAKTGVHHYSGNHTGLGTARGKYCQ<MCTLATTDPGDSDNIGNMPEQTG |
| Parental | EK |
| EK | |
| Retrocopy | EK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 74 .03 RPM |
| SRP017611_kidney | 0 .00 RPM | 230 .75 RPM |
| SRP017611_liver | 0 .00 RPM | 118 .28 RPM |