RetrogeneDB ID: | retro_dnov_334 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | GeneScaffold_3750:69867..70095(-) | ||
| Located in intron of: | ENSDNOG00000002813 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL30 | ||
| Ensembl ID: | ENSDNOG00000013828 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L30 [Source:HGNC Symbol;Acc:10333] |
| Percent Identity: | 81.58 % |
| Parental protein coverage: | 66.09 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | QGKAKLVILANNCPALRKSEIEYYAMLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDIIRSMP |
| .GKAKLVILANNCPALRKSEIEYYAMLAKT.VHH...N.I.LGTA.GKY.RVCTLAI..P.DSDIIRSMP | |
| Retrocopy | EGKAKLVILANNCPALRKSEIEYYAMLAKTSVHH*HDNTIDLGTAHGKYCRVCTLAITNPSDSDIIRSMP |
| Parental | EQTGEK |
| EQ.G.K | |
| Retrocopy | EQIGKK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 222 .47 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 134 .99 RPM |
| SRP012922_heart | 0 .00 RPM | 171 .24 RPM |
| SRP012922_kidney | 0 .00 RPM | 308 .57 RPM |
| SRP012922_liver | 0 .00 RPM | 175 .86 RPM |
| SRP012922_lung | 0 .00 RPM | 422 .89 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 214 .97 RPM |
| SRP012922_spleen | 0 .00 RPM | 422 .02 RPM |