RetrogeneDB ID: | retro_btau_1512 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 6:113900144..113900360(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SUMO1 | ||
| Ensembl ID: | ENSBTAG00000009859 | ||
| Aliases: | None | ||
| Description: | Small ubiquitin-related modifier 1 [Source:UniProtKB/Swiss-Prot;Acc:Q5E9D1] |
| Percent Identity: | 78.08 % |
| Parental protein coverage: | 72.28 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | QDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGH |
| QDSS.IHFK.KMTTHLKKLKES..QRQ..PMNSLR.LFEGQRIADNH.PK.LG...E..IEVYQE.TGGH | |
| Retrocopy | QDSSDIHFKGKMTTHLKKLKESFYQRQDIPMNSLRLLFEGQRIADNHAPKGLGI-KEGMIEVYQEHTGGH |
| Parental | STV |
| ST. | |
| Retrocopy | STI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 56 .38 RPM |
| ERP005899_muscle | 0 .00 RPM | 49 .25 RPM |
| SRP017611_brain | 0 .00 RPM | 27 .54 RPM |
| SRP017611_kidney | 0 .00 RPM | 50 .44 RPM |
| SRP017611_liver | 0 .00 RPM | 17 .67 RPM |
| SRP030211_testis | 0 .00 RPM | 38 .55 RPM |