RetrogeneDB ID: | retro_mmus_2135 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 3:3939246..3939462(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Sumo1 | ||
| Ensembl ID: | ENSMUSG00000026021 | ||
| Aliases: | Sumo1, GMP1, PIC1, SENTRIN, SMT3, SMT3H3, SMTP3, SUMO-1, Smt3C, Ubl1 | ||
| Description: | SMT3 suppressor of mif two 3 homolog 1 (yeast) [Source:MGI Symbol;Acc:MGI:1197010] |
| Percent Identity: | 90.28 % |
| Parental protein coverage: | 71.29 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | VIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQT |
| .IGQDSSE.HFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADN.T.KELGME.EDVI.VYQEQ. | |
| Retrocopy | IIGQDSSELHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNLTLKELGMEKEDVINVYQEQM |
| Parental | GG |
| GG | |
| Retrocopy | GG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 24 .86 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 23 .27 RPM |
| SRP007412_heart | 0 .00 RPM | 14 .60 RPM |
| SRP007412_kidney | 0 .00 RPM | 20 .67 RPM |
| SRP007412_liver | 0 .00 RPM | 12 .70 RPM |
| SRP007412_testis | 0 .00 RPM | 24 .20 RPM |