RetrogeneDB ID: | retro_mmus_2475 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 4:83500494..83500767(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSMUSG00000082416 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Sumo2 | ||
| Ensembl ID: | ENSMUSG00000020738 | ||
| Aliases: | Sumo2, SUMO-2, Smt3A, Smt3b, Smt3h2 | ||
| Description: | SMT3 suppressor of mif two 3 homolog 2 (yeast) [Source:MGI Symbol;Acc:MGI:2158813] |
| Percent Identity: | 65.59 % |
| Parental protein coverage: | 95.79 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
| Parental | EKPKEGVKTENNDHINLKVAGQDGSVVQFKI-KRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDT |
| ..PK.G...ENNDHI.LKV.G.DGSVVQFKI.K...PLSK.MKA.CERQG....Q.RF.FDGQPIN.TDT | |
| Retrocopy | KNPKGGAEPENNDHIILKVVGPDGSVVQFKI>KKLEPLSKAMKAHCERQG**TPQLRFLFDGQPINGTDT |
| Parental | PAQL-EMEDEDTIDVFQQQTGGV |
| P.QL.E.EDEDT..VF.Q..G.. | |
| Retrocopy | PTQL<EAEDEDTSEVFLQRIGAL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .02 RPM | 1 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .78 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .72 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .87 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .25 RPM |
| SRP007412_testis | 0 .00 RPM | 1 .92 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000004724 | 1 retrocopy | |
| Homo sapiens | ENSG00000188612 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000023769 | 3 retrocopies | |
| Loxodonta africana | ENSLAFG00000025811 | 10 retrocopies | |
| Monodelphis domestica | ENSMODG00000007222 | 11 retrocopies | |
| Mus musculus | ENSMUSG00000020265 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000020738 | 19 retrocopies |
retro_mmus_1498, retro_mmus_1772, retro_mmus_1903, retro_mmus_2050, retro_mmus_2323, retro_mmus_2475 , retro_mmus_2492, retro_mmus_2590, retro_mmus_2767, retro_mmus_2917, retro_mmus_2974, retro_mmus_3209, retro_mmus_3414, retro_mmus_3630, retro_mmus_415, retro_mmus_611, retro_mmus_689, retro_mmus_818, retro_mmus_827,
|
| Mus musculus | ENSMUSG00000026021 | 5 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000028195 | 5 retrocopies | |
| Pongo abelii | ENSPPYG00000029777 | 2 retrocopies |