RetrogeneDB ID: | retro_btau_1047 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 24:41743861..41744029(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | BT.106572 | ||
| Ensembl ID: | ENSBTAG00000030169 | ||
| Aliases: | SUMO2, SMT3B, SMT3H2, Smt3A | ||
| Description: | small ubiquitin-related modifier 2 precursor [Source:RefSeq peptide;Acc:NP_777194] |
| Percent Identity: | 64.29 % |
| Parental protein coverage: | 58.95 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected: | 0 |
| Parental | LSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY |
| ...L.KA.CE.QGLSM..I.F.FDGQ.INETDTPAQL.M.DED...V..QQTG.V. | |
| Retrocopy | ITTLIKA*CEWQGLSMKRI*F*FDGQSINETDTPAQL*MDDEDISGVSWQQTGSVF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 22 .42 RPM |
| ERP005899_muscle | 0 .00 RPM | 69 .05 RPM |
| SRP017611_brain | 0 .00 RPM | 19 .60 RPM |
| SRP017611_kidney | 0 .00 RPM | 29 .64 RPM |
| SRP017611_liver | 0 .00 RPM | 8 .53 RPM |
| SRP030211_testis | 0 .00 RPM | 124 .54 RPM |