RetrogeneDB ID: | retro_ocun_321 | ||
Retrocopy location | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | 1:163660227..163660455(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSOCUG00000021739 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 92.11 % |
| Parental protein coverage: | 67.86 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | HTPLSKLMKAYCERQGLSMRQIRFRFDGQPINEADTPAQLEMDDEDTIDVFQQQTGGVSSRLPGRGLFSI |
| H.PLSKLMKAYCERQGLSMRQIR.RFDGQPINEADTPAQLEMDD.DTI.VFQQQTGGV.SRLPGRGLFSI | |
| Retrocopy | HAPLSKLMKAYCERQGLSMRQIRCRFDGQPINEADTPAQLEMDD*DTINVFQQQTGGVTSRLPGRGLFSI |
| Parental | LAFAVE |
| L.FAVE | |
| Retrocopy | LPFAVE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 1 .27 RPM | 20 .53 RPM |
| SRP017611_kidney | 0 .20 RPM | 15 .61 RPM |
| SRP017611_liver | 0 .46 RPM | 6 .09 RPM |