RetrogeneDB ID: | retro_mmur_1177 | ||
Retrocopy location | Organism: | Mouse Lemur (Microcebus murinus) | |
| Coordinates: | scaffold_29066:1372..1597(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SUMO1 | ||
| Ensembl ID: | ENSMICG00000008968 | ||
| Aliases: | None | ||
| Description: | small ubiquitin-like modifier 1 [Source:HGNC Symbol;Acc:12502] |
| Percent Identity: | 100.0 % |
| Parental protein coverage: | 77.32 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | EAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADN |
| EAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADN | |
| Retrocopy | EAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADN |
| Parental | HTPKE |
| HTPKE | |
| Retrocopy | HTPKE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000009859 | 6 retrocopies | |
| Canis familiaris | ENSCAFG00000012431 | 8 retrocopies | |
| Felis catus | ENSFCAG00000031005 | 6 retrocopies | |
| Loxodonta africana | ENSLAFG00000022855 | 5 retrocopies | |
| Microcebus murinus | ENSMICG00000008968 | 5 retrocopies | |
| Microcebus murinus | ENSMICG00000011011 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000007504 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000005240 | 7 retrocopies | |
| Otolemur garnettii | ENSOGAG00000030345 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000006870 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000013083 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000012817 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000011968 | 1 retrocopy |