RetrogeneDB ID: | retro_mmus_944 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 12:67926043..67926259(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Tmem167 | ||
| Ensembl ID: | ENSMUSG00000012422 | ||
| Aliases: | None | ||
| Description: | transmembrane protein 167 [Source:MGI Symbol;Acc:MGI:1913324] |
| Percent Identity: | 80.56 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | MSAIFNFQSLLTVILLLICTCAYIRSLAPSILDRNKTGLLGIFWKCARIGERKSPYVAICCIVMAFSILF |
| MSA.FNFQ.LLTVILL.I...AYIRSLAPSI.DRNKTGLLGI.WK..RIGE..SPYV.ICCI.MAFSILF | |
| Retrocopy | MSAVFNFQTLLTVILLRIRMHAYIRSLAPSIQDRNKTGLLGIIWK*TRIGEYRSPYVMICCIGMAFSILF |
| Parental | IQ |
| IQ | |
| Retrocopy | IQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 42 .96 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 32 .26 RPM |
| SRP007412_heart | 0 .00 RPM | 11 .89 RPM |
| SRP007412_kidney | 0 .00 RPM | 21 .54 RPM |
| SRP007412_liver | 0 .00 RPM | 30 .39 RPM |
| SRP007412_testis | 0 .00 RPM | 8 .46 RPM |