RetrogeneDB ID: | retro_dnov_550 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | GeneScaffold_6047:54498..54710(+) | ||
| Located in intron of: | ENSDNOG00000017558 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | TMEM167A | ||
| Ensembl ID: | ENSDNOG00000003073 | ||
| Aliases: | None | ||
| Description: | transmembrane protein 167A [Source:HGNC Symbol;Acc:28330] |
| Percent Identity: | 83.33 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | SAIFNFQSLLTVILLLICTCAYIRSLAPSLLDRNKTGLLGIFWKCARIGER-KSPYVAVCCIVMAFSILF |
| SAIFNFQ.LLTVILLLIC.CAYI.SL..SLLDRNKT.L.GIFWKCARIGE..KSPYVA.C.IV.AFSILF | |
| Retrocopy | SAIFNFQCLLTVILLLICSCAYIQSLELSLLDRNKTELFGIFWKCARIGEQ<KSPYVAICYIVTAFSILF |
| Parental | VQ |
| VQ | |
| Retrocopy | VQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 2 .92 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 0 .41 RPM |
| SRP012922_heart | 0 .00 RPM | 0 .70 RPM |
| SRP012922_kidney | 0 .00 RPM | 1 .37 RPM |
| SRP012922_liver | 0 .00 RPM | 0 .77 RPM |
| SRP012922_lung | 0 .00 RPM | 1 .53 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 0 .87 RPM |
| SRP012922_spleen | 0 .00 RPM | 1 .60 RPM |