RetrogeneDB ID: | retro_fcat_1548 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
| Coordinates: | D3:46458986..46459203(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | TMEM167A | ||
| Ensembl ID: | ENSFCAG00000012375 | ||
| Aliases: | None | ||
| Description: | transmembrane protein 167A [Source:HGNC Symbol;Acc:28330] |
| Percent Identity: | 71.23 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 1 |
| Parental | SAIFNFQSLLTVILLLICTCAYIRSLAPSLLDRNKTGLLGIFWKCARIGERKSPYV-AVCC-IVMAFSIL |
| SAIFN.QSLLTVILLL..TCAYI..LAP..LDRNKTGLLG.F.KCARIGERK.....A..C.IV.A.S.L | |
| Retrocopy | SAIFNVQSLLTVILLLK*TCAYI*PLAPRPLDRNKTGLLGTF*KCARIGERKTGSL>AAVCHIVLASSLL |
| Parental | FIQ |
| FI. | |
| Retrocopy | FIR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 11 .94 RPM |
| SRP017611_kidney | 0 .00 RPM | 9 .17 RPM |
| SRP017611_liver | 0 .00 RPM | 8 .29 RPM |