RetrogeneDB ID: | retro_ecab_690 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
| Coordinates: | 28:41121762..41121974(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | TMEM167A | ||
| Ensembl ID: | ENSECAG00000026834 | ||
| Aliases: | None | ||
| Description: | transmembrane protein 167A [Source:HGNC Symbol;Acc:28330] |
| Percent Identity: | 83.33 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | SAIFNFQSLLTVILLL-ICTCAYIRSLAPSLLDRNKTGLLGIFWKCARIGERKSPYVAICCIVMAFSILF |
| SAIFNFQSLLTVI.LL.ICTCAYIRSLAPSLLDR.KTGLLGIF.KCARI.E.KSPYV...C.V.AFSIL. | |
| Retrocopy | SAIFNFQSLLTVISLL<ICTCAYIRSLAPSLLDRKKTGLLGIFCKCARISEQKSPYVVTRCTVIAFSILS |
| Parental | IQ |
| IQ | |
| Retrocopy | IQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 3 .95 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 2 .18 RPM |
| SRP021940_embryo | 0 .00 RPM | 3 .40 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 5 .97 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 4 .23 RPM |
| SRP021940_testis | 0 .00 RPM | 3 .39 RPM |