RetrogeneDB ID: | retro_btau_852 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
| Coordinates: | 2:6101526..6101741(-) | ||
| Located in intron of: | ENSBTAG00000026994 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | TMEM167A | ||
| Ensembl ID: | ENSBTAG00000039591 | ||
| Aliases: | TMEM167A, TMEM167 | ||
| Description: | Protein kish-A [Source:UniProtKB/Swiss-Prot;Acc:Q148I3] |
| Percent Identity: | 91.78 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | MSAIFNFQSLLTVILLLICTCAYIRSLAPSLLDRNKTGLLGIFWKCARIGERKSPYVAVC-CIVMAFSIL |
| MSAIFNFQSLL.VILLLICT.AYIR.LAPSLLDRNKTGLLGIFWKCARIGERKSPYVAVC..IVMAF.IL | |
| Retrocopy | MSAIFNFQSLLAVILLLICTYAYIRFLAPSLLDRNKTGLLGIFWKCARIGERKSPYVAVC<LIVMAFNIL |
| Parental | FIQ |
| FIQ | |
| Retrocopy | FIQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .07 RPM | 98 .34 RPM |
| ERP005899_muscle | 0 .00 RPM | 34 .00 RPM |
| SRP017611_brain | 0 .00 RPM | 28 .73 RPM |
| SRP017611_kidney | 0 .00 RPM | 36 .16 RPM |
| SRP017611_liver | 0 .00 RPM | 63 .65 RPM |
| SRP030211_testis | 0 .05 RPM | 25 .18 RPM |