RetrogeneDB ID: | retro_fcat_180 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
| Coordinates: | A1:137054479..137054692(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | TMEM167A | ||
| Ensembl ID: | ENSFCAG00000012375 | ||
| Aliases: | None | ||
| Description: | transmembrane protein 167A [Source:HGNC Symbol;Acc:28330] |
| Percent Identity: | 87.32 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | SAIFNFQSLLTVILLLICTCAYIRSLAPSLLDRNKTGLLGIFWKCARIGERKSPYVAVCCIVMAFSILFI |
| SAIFNFQS.LTVILLLI..CAYI.SLA.SLLDRNKTGLLGIFWKC.RIGE.KS.YVAVCCIVMAFS.LFI | |
| Retrocopy | SAIFNFQSQLTVILLLIYSCAYIPSLAHSLLDRNKTGLLGIFWKCSRIGEQKSLYVAVCCIVMAFSFLFI |
| Parental | Q |
| Q | |
| Retrocopy | Q |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 11 .94 RPM |
| SRP017611_kidney | 0 .00 RPM | 9 .17 RPM |
| SRP017611_liver | 0 .00 RPM | 8 .29 RPM |