RetrogeneDB ID: | retro_mdom_1169 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 3:343308467..343308680(-) | ||
| Located in intron of: | ENSMODG00000008762 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSMODG00000025616 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 85.92 % |
| Parental protein coverage: | 98.61 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | MSAIFNFQSLLTVILLLICTCAYIRSLAPSILDKNKTGLLGIFWKCARIGERKSPYVAVCCIVMAFSILF |
| MSAIFNFQSLLT..LLLI.TCAYIRSL.PS.L.KNKTGL.GIFWKCARI.E.KSPYVAVCCIVM.FSILF | |
| Retrocopy | MSAIFNFQSLLTIVLLLIYTCAYIRSLTPSFLYKNKTGLFGIFWKCARISE*KSPYVAVCCIVMTFSILF |
| Parental | I |
| I | |
| Retrocopy | I |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |