RetrogeneDB ID: | retro_sscr_351 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 13:168221319..168221532(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TMEM167A | ||
| Ensembl ID: | ENSSSCG00000029173 | ||
| Aliases: | None | ||
| Description: | transmembrane protein 167A [Source:HGNC Symbol;Acc:28330] |
| Percent Identity: | 90.14 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | SAIFNFQSLLTVILLLICTCAYIRSLAPSLLDRNKTGLLGIFWKCARIGERKSPYVAVCCVVMAFSILFI |
| SAIFNFQSLLTVILLLICT...I.SLAPSLLDRNKTGLLGI.WKCARI.E.KSPYVAVCCVVMAFSILFI | |
| Retrocopy | SAIFNFQSLLTVILLLICTST*I*SLAPSLLDRNKTGLLGILWKCARIDEQKSPYVAVCCVVMAFSILFI |
| Parental | Q |
| Q | |
| Retrocopy | Q |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .40 RPM | 3 .45 RPM |
| SRP014902_testis | 0 .28 RPM | 3 .25 RPM |
| SRP018288_heart | 0 .03 RPM | 6 .84 RPM |
| SRP018288_kidney | 0 .00 RPM | 11 .92 RPM |
| SRP018288_liver | 0 .00 RPM | 12 .63 RPM |
| SRP018288_lung | 0 .00 RPM | 3 .36 RPM |
| SRP018856_adipose | 0 .00 RPM | 7 .35 RPM |
| SRP035408_brain | 0 .00 RPM | 4 .86 RPM |
| SRP035408_liver | 0 .00 RPM | 9 .80 RPM |